Class a: All alpha proteins [46456] (289 folds) |
Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies) 5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology |
Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families) |
Family a.246.1.1: Hyaluronidase post-catalytic domain-like [140658] (2 proteins) |
Protein Glucosaminidase GH84 post-catalytic domain [140661] (1 species) |
Species Bacteroides thetaiotaomicron [TaxId:818] [140662] (8 PDB entries) Uniprot Q89ZI2 458-610! Uniprot Q89ZI2 458-611 |
Domain d2vvnb1: 2vvn B:437-589 [153637] Other proteins in same PDB: d2vvna2, d2vvna3, d2vvnb2, d2vvnb3 automatically matched to 2J4G A:437-589 complexed with gol, nh4, nht |
PDB Entry: 2vvn (more details), 1.85 Å
SCOPe Domain Sequences for d2vvnb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vvnb1 a.246.1.1 (B:437-589) Glucosaminidase GH84 post-catalytic domain {Bacteroides thetaiotaomicron [TaxId: 818]} reesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkpliveit pwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpyqpgvkt atrvikplidrtfatvvkffnqkfnahldattd
Timeline for d2vvnb1: