Lineage for d2vvnb1 (2vvn B:437-589)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2351179Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
    5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology
  4. 2351180Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families) (S)
  5. 2351181Family a.246.1.1: Hyaluronidase post-catalytic domain-like [140658] (2 proteins)
  6. 2351182Protein Glucosaminidase GH84 post-catalytic domain [140661] (1 species)
  7. 2351183Species Bacteroides thetaiotaomicron [TaxId:818] [140662] (8 PDB entries)
    Uniprot Q89ZI2 458-610! Uniprot Q89ZI2 458-611
  8. 2351187Domain d2vvnb1: 2vvn B:437-589 [153637]
    Other proteins in same PDB: d2vvna2, d2vvna3, d2vvnb2, d2vvnb3
    automatically matched to 2J4G A:437-589
    complexed with gol, nh4, nht

Details for d2vvnb1

PDB Entry: 2vvn (more details), 1.85 Å

PDB Description: btgh84 in complex with nh-butylthiazoline
PDB Compounds: (B:) o-glcnacase bt_4395

SCOPe Domain Sequences for d2vvnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vvnb1 a.246.1.1 (B:437-589) Glucosaminidase GH84 post-catalytic domain {Bacteroides thetaiotaomicron [TaxId: 818]}
reesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkpliveit
pwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpyqpgvkt
atrvikplidrtfatvvkffnqkfnahldattd

SCOPe Domain Coordinates for d2vvnb1:

Click to download the PDB-style file with coordinates for d2vvnb1.
(The format of our PDB-style files is described here.)

Timeline for d2vvnb1: