Lineage for d2vumk1 (2vum K:1-114)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1071279Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 1071280Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 1071281Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 1071282Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)
  7. 1071283Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (23 PDB entries)
  8. 1071296Domain d2vumk1: 2vum K:1-114 [153555]
    Other proteins in same PDB: d2vumb1, d2vumf1, d2vumh1, d2vumj1, d2vuml1
    automatically matched to d1wcmk_
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2vumk1

PDB Entry: 2vum (more details), 3.4 Å

PDB Description: alpha-amanitin inhibited complete rna polymerase ii elongation complex
PDB Compounds: (K:) DNA-directed RNA polymerase II subunit RPB11

SCOPe Domain Sequences for d2vumk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vumk1 i.8.1.1 (K:1-114) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl

SCOPe Domain Coordinates for d2vumk1:

Click to download the PDB-style file with coordinates for d2vumk1.
(The format of our PDB-style files is described here.)

Timeline for d2vumk1: