Lineage for d2vumh1 (2vum H:2-146)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2059387Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2060352Family b.40.4.8: RNA polymerase subunit RBP8 [50321] (1 protein)
    duplication; contains tandem repeat of two incomplete OB-folds; forms a single barrel; n=8, S=10
    automatically mapped to Pfam PF03870
  6. 2060353Protein RNA polymerase subunit RBP8 [50322] (2 species)
  7. 2060354Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50323] (35 PDB entries)
    Uniprot P20436
  8. 2060378Domain d2vumh1: 2vum H:2-146 [153553]
    Other proteins in same PDB: d2vuma1, d2vumb1, d2vumd1, d2vumf1, d2vumg1, d2vumj1, d2vumk1, d2vuml1
    automatically matched to d1a1da_
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2vumh1

PDB Entry: 2vum (more details), 3.4 Å

PDB Description: alpha-amanitin inhibited complete rna polymerase ii elongation complex
PDB Compounds: (H:) DNA-directed RNA polymerases I, II, and III subunit RPABC3

SCOPe Domain Sequences for d2vumh1:

Sequence, based on SEQRES records: (download)

>d2vumh1 b.40.4.8 (H:2-146) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
slnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggl
lmrlegnyrnlnnlkqenayllirr

Sequence, based on observed residues (ATOM records): (download)

>d2vumh1 b.40.4.8 (H:2-146) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
sltrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggllmrlegnyrnln
nlkqenayllirr

SCOPe Domain Coordinates for d2vumh1:

Click to download the PDB-style file with coordinates for d2vumh1.
(The format of our PDB-style files is described here.)

Timeline for d2vumh1: