SCOPe 2.06: Domain d2vrya_: 2vry A:

Lineage for d2vrya_ (2vry A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (42 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187190] (2 PDB entries)

8. Domain d2vrya_: 2vry A: [153525]
   automated match to d1q1fa_
   complexed with hem, so4

Details for d2vrya_

PDB Entry: 2vry, 1.87 Å

PDB Description: mouse neuroglobin with heme iron in the reduced ferrous state

PDB Compounds: (A:) neuroglobin

SCOPe Domain Sequences for d2vrya_:

Sequence; same for both SEQRES and ATOM records:

>d2vrya_ a.1.1.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspefl
dhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllymlekslg
pdftpatrtawsrlygavvqamsrgwd

Timeline for d2vrya_:

• d2vrya_ first appeared in SCOP 1.75, called d2vrya1
  
• d2vrya_ appears in SCOPe 2.05
  
• d2vrya_ appears in SCOPe 2.07
  
• d2vrya_ appears in the current release, SCOPe 2.08