Lineage for d2vrrb1 (2vrr B:20-97)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194674Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1194675Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1194676Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1194772Protein SUMO-1 (smt3 homologue) [54241] (2 species)
  7. 1194778Species Human (Homo sapiens) [TaxId:9606] [54242] (12 PDB entries)
    Uniprot Q93068
  8. 1194780Domain d2vrrb1: 2vrr B:20-97 [153523]
    Other proteins in same PDB: d2vrra_
    automatically matched to d1tgzb_
    complexed with fmt, na

Details for d2vrrb1

PDB Entry: 2vrr (more details), 2.22 Å

PDB Description: structure of sumo modified ubc9
PDB Compounds: (B:) Small ubiquitin-related modifier 1

SCOPe Domain Sequences for d2vrrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vrrb1 d.15.1.1 (B:20-97) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]}
eyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpke
lgmeeedvievyqeqtgg

SCOPe Domain Coordinates for d2vrrb1:

Click to download the PDB-style file with coordinates for d2vrrb1.
(The format of our PDB-style files is described here.)

Timeline for d2vrrb1: