Class b: All beta proteins [48724] (176 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (31 species) not a true protein |
Species Bacteroides thetaiotaomicron [TaxId:226186] [255611] (7 PDB entries) |
Domain d2vr4b4: 2vr4 B:27-219 [153503] Other proteins in same PDB: d2vr4a1, d2vr4a2, d2vr4a3, d2vr4a5, d2vr4b1, d2vr4b2, d2vr4b3, d2vr4b5 automated match to d2je8a4 complexed with 17b, br, cl, edo |
PDB Entry: 2vr4 (more details), 1.8 Å
SCOPe Domain Sequences for d2vr4b4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vr4b4 b.18.1.0 (B:27-219) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]} gndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwven edweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvlr kgenhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmvt sgvwrpvtlrfyd
Timeline for d2vr4b4: