Lineage for d2vr4b2 (2vr4 B:784-864)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762928Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2762929Protein automated matches [254633] (19 species)
    not a true protein
  7. 2762955Species Bacteroides thetaiotaomicron [TaxId:226186] [255613] (7 PDB entries)
  8. 2762966Domain d2vr4b2: 2vr4 B:784-864 [153501]
    Other proteins in same PDB: d2vr4a4, d2vr4a5, d2vr4b4, d2vr4b5, d2vr4b6
    automated match to d2je8a2
    complexed with 17b, br, cl, edo

Details for d2vr4b2

PDB Entry: 2vr4 (more details), 1.8 Å

PDB Description: transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-d structure
PDB Compounds: (B:) beta-mannosidase

SCOPe Domain Sequences for d2vr4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vr4b2 b.1.4.0 (B:784-864) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
lpptsvsyqmkqtdgkceltlfssmlakdifietplqgarysdnffdllpgerkkviits
prikkgeelpvnikhiretyk

SCOPe Domain Coordinates for d2vr4b2:

Click to download the PDB-style file with coordinates for d2vr4b2.
(The format of our PDB-style files is described here.)

Timeline for d2vr4b2: