Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (23 species) |
Species Human (Homo sapiens) [TaxId:9606] [46487] (213 PDB entries) Uniprot P69905 P01922 P01934 P01935 |
Domain d1abya1: 1aby A:1-142 [15349] Other proteins in same PDB: d1abyb_, d1abyd_ recombinant hemoglobin; two alpha subunits fused in a single chain complexed with cyn, hem |
PDB Entry: 1aby (more details), 2.6 Å
SCOPe Domain Sequences for d1abya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1abya1 a.1.1.2 (A:1-142) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]} mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa vhasldkflasvstvltskyrg
Timeline for d1abya1: