SCOPe 2.03: Domain d1abya1: 1aby A:1-142

Lineage for d1abya1 (1aby A:1-142)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (23 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46487] (213 PDB entries)
   Uniprot P69905 P01922 P01934 P01935

8. Domain d1abya1: 1aby A:1-142 [15349]
   Other proteins in same PDB: d1abyb_, d1abyd_
   recombinant hemoglobin; two alpha subunits fused in a single chain
   complexed with cyn, hem

Details for d1abya1

PDB Entry: 1aby, 2.6 Å

PDB Description: cyanomet rhb1.1 (recombinant hemoglobin)

PDB Compounds: (A:) hemoglobin

SCOPe Domain Sequences for d1abya1:

Sequence; same for both SEQRES and ATOM records:

>d1abya1 a.1.1.2 (A:1-142) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]}
mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyrg

Timeline for d1abya1:

• d1abya1 first appeared (with stable ids) in SCOP 1.55
  
• d1abya1 appears in SCOPe 2.02
  
• d1abya1 appears in SCOPe 2.04
  
• d1abya1 appears in the current release, SCOPe 2.08