Lineage for d2vqub3 (2vqu B:784-867)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1521823Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 1521824Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 1522240Protein Beta-mannosidase, domains 2, 4 and 5 [158905] (1 species)
    truncated domain 5 lacks the last strand
  7. 1522241Species Bacteroides thetaiotaomicron [TaxId:818] [158906] (2 PDB entries)
    Uniprot Q8AAK6 220-330! Uniprot Q8AAK6 679-783! Uniprot Q8AAK6 784-864
  8. 1522253Domain d2vqub3: 2vqu B:784-867 [153486]
    Other proteins in same PDB: d2vqua4, d2vqua5, d2vqub4, d2vqub5
    automated match to d2vqua3
    complexed with br, cl, edo, noy

Details for d2vqub3

PDB Entry: 2vqu (more details), 1.9 Å

PDB Description: structural and biochemical evidence for a boat-like transition state in beta-mannosidases
PDB Compounds: (B:) beta-mannosidase

SCOPe Domain Sequences for d2vqub3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vqub3 b.1.4.1 (B:784-867) Beta-mannosidase, domains 2, 4 and 5 {Bacteroides thetaiotaomicron [TaxId: 818]}
lpptsvsyqmkqtdgkceltlfssmlakdifietplqgarysdnffdllpgerkkviits
prikkgeelpvnikhiretykehh

SCOPe Domain Coordinates for d2vqub3:

Click to download the PDB-style file with coordinates for d2vqub3.
(The format of our PDB-style files is described here.)

Timeline for d2vqub3: