Lineage for d2vqub1 (2vqu B:679-783)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1768157Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 1768158Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 1768582Protein Beta-mannosidase, domains 2, 4 and 5 [158905] (1 species)
    truncated domain 5 lacks the last strand
  7. 1768583Species Bacteroides thetaiotaomicron [TaxId:818] [158906] (2 PDB entries)
    Uniprot Q8AAK6 220-330! Uniprot Q8AAK6 679-783! Uniprot Q8AAK6 784-864
  8. 1768593Domain d2vqub1: 2vqu B:679-783 [153484]
    Other proteins in same PDB: d2vqua4, d2vqua5, d2vqub4, d2vqub5
    automated match to d2vqua1
    complexed with br, cl, edo, noy

Details for d2vqub1

PDB Entry: 2vqu (more details), 1.9 Å

PDB Description: structural and biochemical evidence for a boat-like transition state in beta-mannosidases
PDB Compounds: (B:) beta-mannosidase

SCOPe Domain Sequences for d2vqub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vqub1 b.1.4.1 (B:679-783) Beta-mannosidase, domains 2, 4 and 5 {Bacteroides thetaiotaomicron [TaxId: 818]}
vlinpiqqndslsvylisdrldtmeqmtlemkvvdfdgktlgkkiqvhslevpantskcv
yrakldgwltpedcrrsflklilkdksghqvaesvhffrktkdlq

SCOPe Domain Coordinates for d2vqub1:

Click to download the PDB-style file with coordinates for d2vqub1.
(The format of our PDB-style files is described here.)

Timeline for d2vqub1: