Lineage for d2vqua4 (2vqu A:28-219)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1304969Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1304970Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1305080Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 1305230Protein Beta-mannosidase [158959] (1 species)
  7. 1305231Species Bacteroides thetaiotaomicron [TaxId:818] [158960] (9 PDB entries)
    Uniprot Q8AAK6 28-219
  8. 1305240Domain d2vqua4: 2vqu A:28-219 [153482]
    Other proteins in same PDB: d2vqua1, d2vqua2, d2vqua3, d2vqua5, d2vqub1, d2vqub2, d2vqub3, d2vqub5
    complexed with br, cl, edo, noy

Details for d2vqua4

PDB Entry: 2vqu (more details), 1.9 Å

PDB Description: structural and biochemical evidence for a boat-like transition state in beta-mannosidases
PDB Compounds: (A:) beta-mannosidase

SCOPe Domain Sequences for d2vqua4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vqua4 b.18.1.5 (A:28-219) Beta-mannosidase {Bacteroides thetaiotaomicron [TaxId: 818]}
ndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwvene
dweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvlrk
genhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmvts
gvwrpvtlrfyd

SCOPe Domain Coordinates for d2vqua4:

Click to download the PDB-style file with coordinates for d2vqua4.
(The format of our PDB-style files is described here.)

Timeline for d2vqua4: