![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (47 species) not a true protein |
![]() | Domain d2vqtb4: 2vqt B:28-219 [153477] Other proteins in same PDB: d2vqta1, d2vqta2, d2vqta3, d2vqta5, d2vqtb1, d2vqtb2, d2vqtb3, d2vqtb5, d2vqtb6 automated match to d2je8a4 complexed with 15a, br, cl, edo |
PDB Entry: 2vqt (more details), 2.1 Å
SCOPe Domain Sequences for d2vqtb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vqtb4 b.18.1.0 (B:28-219) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]} ndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwvene dweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvlrk genhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmvts gvwrpvtlrfyd
Timeline for d2vqtb4: