![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
![]() | Protein automated matches [190057] (27 species) not a true protein |
![]() | Domain d2vqta5: 2vqt A:331-678 [153473] Other proteins in same PDB: d2vqta1, d2vqta2, d2vqta3, d2vqta4, d2vqtb1, d2vqtb2, d2vqtb3, d2vqtb4, d2vqtb6 automated match to d2je8a5 complexed with 15a, br, cl, edo |
PDB Entry: 2vqt (more details), 2.1 Å
SCOPe Domain Sequences for d2vqta5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vqta5 c.1.8.3 (A:331-678) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]} rtirvvnekdkdgesfyfevngipmfakganyipqdallpnvtteryqtlfrdmkeanmn mvriwgggtyennlfydladengilvwqdfmfactpypsdptflkrveaeavynirrlrn haslamwcgnneilealkywgfekkftpevyqglmhgydklfrellpstvkefdsdrfyv hsspylanwgrpeswgtgdshnwgvwygkkpfesldtdlprfmsefgfqsfpemktiaaf aapedyqiesevmnahqkssignslirtymerdyiipesfedfvyvglvlqgqgmrhgle ahrrnrpycmgtlywqlndswpvvswssidyygnwkalhyqakrafap
Timeline for d2vqta5: