Class b: All beta proteins [48724] (176 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (24 species) not a true protein |
Domain d2vqta4: 2vqt A:28-219 [153472] Other proteins in same PDB: d2vqta1, d2vqta2, d2vqta3, d2vqta5, d2vqtb1, d2vqtb2, d2vqtb3, d2vqtb5 automated match to d2je8a4 complexed with 15a, br, cl, edo |
PDB Entry: 2vqt (more details), 2.1 Å
SCOPe Domain Sequences for d2vqta4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vqta4 b.18.1.0 (A:28-219) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]} ndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwvene dweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvlrk genhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmvts gvwrpvtlrfyd
Timeline for d2vqta4: