Lineage for d2vqta1 (2vqt A:220-330)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1521823Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 1522274Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 1522275Protein automated matches [254633] (4 species)
    not a true protein
  7. Species Bacteroides thetaiotaomicron [TaxId:818] [255621] (1 PDB entry)
  8. 1522345Domain d2vqta1: 2vqt A:220-330 [153469]
    Other proteins in same PDB: d2vqta4, d2vqta5, d2vqtb4, d2vqtb5
    automated match to d2je8a1
    complexed with 15a, br, cl, edo

Details for d2vqta1

PDB Entry: 2vqt (more details), 2.1 Å

PDB Description: structural and biochemical evidence for a boat-like transition state in beta-mannosidases
PDB Compounds: (A:) beta-mannosidase

SCOPe Domain Sequences for d2vqta1:

Sequence, based on SEQRES records: (download)

>d2vqta1 b.1.4.0 (A:220-330) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]}
iatisdyyvrqlsltdenarlsnelivnqivpqkipaevrvnvslngttvtevkqqvtlq
pginhitlpaevtnpvrwmpngwgtptlydfsaqiacgdrivaeqshrigl

Sequence, based on observed residues (ATOM records): (download)

>d2vqta1 b.1.4.0 (A:220-330) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]}
iatisdyyvrqlsltdenarlsnelivnqivpqkipaevrvnvslngttvtevkqqvtlq
pginhitlpaevtnpvrwmpngwgtptlydfsaqiacgrivaeqshrigl

SCOPe Domain Coordinates for d2vqta1:

Click to download the PDB-style file with coordinates for d2vqta1.
(The format of our PDB-style files is described here.)

Timeline for d2vqta1: