Lineage for d2vqfs1 (2vqf S:2-81)

  1. Root: SCOPe 2.02
  2. 1248417Class i: Low resolution protein structures [58117] (25 folds)
  3. 1248418Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1248419Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1248420Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1248421Protein 70S ribosome functional complex [58121] (9 species)
  7. 1249067Species Thermus thermophilus [TaxId:274] [58122] (21 PDB entries)
  8. 1249075Domain d2vqfs1: 2vqf S:2-81 [153462]
    Other proteins in same PDB: d2vqfb1, d2vqfd1, d2vqfe1, d2vqff1, d2vqfg1, d2vqfh1, d2vqfi1, d2vqfj1, d2vqfk1, d2vqfm1, d2vqfn1, d2vqfq1, d2vqfr1, d2vqft1, d2vqfu1
    automatically matched to d1ibms_
    complexed with k, mg, par, zn

Details for d2vqfs1

PDB Entry: 2vqf (more details), 2.9 Å

PDB Description: modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
PDB Compounds: (S:) 30S ribosomal protein S19

SCOPe Domain Sequences for d2vqfs1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vqfs1 i.1.1.1 (S:2-81) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

SCOPe Domain Coordinates for d2vqfs1:

Click to download the PDB-style file with coordinates for d2vqfs1.
(The format of our PDB-style files is described here.)

Timeline for d2vqfs1: