Lineage for d2vqfl1 (2vqf L:5-128)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2647133Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2647134Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2647135Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 2647136Protein 70S ribosome functional complex [58121] (4 species)
  7. 2647693Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)
  8. 2647722Domain d2vqfl1: 2vqf L:5-128 [153455]
    Other proteins in same PDB: d2vqfb1, d2vqfd1, d2vqfe1, d2vqff1, d2vqfg1, d2vqfh1, d2vqfi1, d2vqfj1, d2vqfk1, d2vqfm1, d2vqfn1, d2vqfq1, d2vqfr1, d2vqft1, d2vqfu1
    automatically matched to d1gixo_
    complexed with k, mg, par, zn

Details for d2vqfl1

PDB Entry: 2vqf (more details), 2.9 Å

PDB Description: modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
PDB Compounds: (L:) 30S ribosomal protein S12

SCOPe Domain Sequences for d2vqfl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vqfl1 i.1.1.1 (L:5-128) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkea

SCOPe Domain Coordinates for d2vqfl1:

Click to download the PDB-style file with coordinates for d2vqfl1.
(The format of our PDB-style files is described here.)

Timeline for d2vqfl1: