Lineage for d2vqfk1 (2vqf K:11-126)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 995076Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 996570Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 996571Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 996661Protein Ribosomal protein S11 [53141] (2 species)
  7. 996687Species Thermus thermophilus [TaxId:274] [53142] (46 PDB entries)
    Uniprot P80376
  8. 996690Domain d2vqfk1: 2vqf K:11-126 [153454]
    Other proteins in same PDB: d2vqfb1, d2vqfd1, d2vqfe1, d2vqff1, d2vqfg1, d2vqfh1, d2vqfi1, d2vqfj1, d2vqfl1, d2vqfm1, d2vqfn1, d2vqfo1, d2vqfp1, d2vqfq1, d2vqfr1, d2vqfs1, d2vqft1, d2vqfu1
    automatically matched to d1i94k_
    complexed with k, mg, par, zn

Details for d2vqfk1

PDB Entry: 2vqf (more details), 2.9 Å

PDB Description: modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
PDB Compounds: (K:) 30S ribosomal protein S11

SCOPe Domain Sequences for d2vqfk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vqfk1 c.55.4.1 (K:11-126) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]}
krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfr

SCOPe Domain Coordinates for d2vqfk1:

Click to download the PDB-style file with coordinates for d2vqfk1.
(The format of our PDB-style files is described here.)

Timeline for d2vqfk1: