Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily) alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta |
Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) common motif in otherwise different folds |
Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein) has a RRF/tRNA synthetase additional domain-like fold |
Protein Ribosomal protein S4 [55179] (3 species) also contains a Zn-binding N-terminal subdomain |
Species Thermus thermophilus [TaxId:274] [55180] (45 PDB entries) |
Domain d2vqfd1: 2vqf D:2-209 [153447] Other proteins in same PDB: d2vqfb1, d2vqfe1, d2vqff1, d2vqfg1, d2vqfh1, d2vqfi1, d2vqfj1, d2vqfk1, d2vqfl1, d2vqfm1, d2vqfn1, d2vqfo1, d2vqfp1, d2vqfq1, d2vqfr1, d2vqfs1, d2vqft1, d2vqfu1 automatically matched to d1hnwd_ complexed with k, mg, par, zn |
PDB Entry: 2vqf (more details), 2.9 Å
SCOPe Domain Sequences for d2vqfd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vqfd1 d.66.1.2 (D:2-209) Ribosomal protein S4 {Thermus thermophilus [TaxId: 274]} gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm kgkflrlpdredlalpvneqlviefysr
Timeline for d2vqfd1: