Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
Protein 70S ribosome functional complex [58121] (9 species) |
Species Thermus thermophilus [TaxId:274] [58122] (21 PDB entries) |
Domain d2vqep1: 2vqe P:1-83 [153440] Other proteins in same PDB: d2vqeb1, d2vqed1, d2vqee1, d2vqef1, d2vqeg1, d2vqeh1, d2vqei1, d2vqej1, d2vqek1, d2vqem1, d2vqen1, d2vqeq1, d2vqer1, d2vqet1, d2vqeu1 automatically matched to d1ibkp_ complexed with k, mg, par, zn |
PDB Entry: 2vqe (more details), 2.5 Å
SCOPe Domain Sequences for d2vqep1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vqep1 i.1.1.1 (P:1-83) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]} mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl svgaqptdtarrllrqagvfrqe
Timeline for d2vqep1: