Lineage for d2vqel1 (2vqe L:5-128)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2647133Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2647134Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2647135Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 2647136Protein 70S ribosome functional complex [58121] (4 species)
  7. 2647693Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)
  8. 2647694Domain d2vqel1: 2vqe L:5-128 [153436]
    Other proteins in same PDB: d2vqeb1, d2vqed1, d2vqee1, d2vqef1, d2vqeg1, d2vqeh1, d2vqei1, d2vqej1, d2vqek1, d2vqem1, d2vqen1, d2vqeq1, d2vqer1, d2vqet1, d2vqeu1
    automatically matched to d1gixo_
    complexed with k, mg, par, zn

Details for d2vqel1

PDB Entry: 2vqe (more details), 2.5 Å

PDB Description: modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
PDB Compounds: (L:) 30S ribosomal protein S12

SCOPe Domain Sequences for d2vqel1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vqel1 i.1.1.1 (L:5-128) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkea

SCOPe Domain Coordinates for d2vqel1:

Click to download the PDB-style file with coordinates for d2vqel1.
(The format of our PDB-style files is described here.)

Timeline for d2vqel1: