Lineage for d2vqee1 (2vqe E:5-154)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2647133Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2647134Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2648718Family i.1.1.3: Small subunit [58132] (3 proteins)
  6. 2648796Protein Prokaryotic (30S subunit) [58133] (1 species)
  7. 2648797Species Thermus thermophilus [TaxId:274] [58134] (13 PDB entries)
  8. 2648798Domain d2vqee1: 2vqe E:5-154 [153429]
    Other proteins in same PDB: d2vqeb1, d2vqed1, d2vqef1, d2vqeg1, d2vqeh1, d2vqei1, d2vqej1, d2vqek1, d2vqel1, d2vqem1, d2vqen1, d2vqeo1, d2vqep1, d2vqeq1, d2vqer1, d2vqes1, d2vqet1, d2vqeu1
    automatically matched to d1fkae_
    complexed with k, mg, par, zn

Details for d2vqee1

PDB Entry: 2vqe (more details), 2.5 Å

PDB Description: modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d2vqee1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vqee1 i.1.1.3 (E:5-154) Prokaryotic (30S subunit) {Thermus thermophilus [TaxId: 274]}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelg
srnpiniayatmealrqlrtkadverlrkg

SCOPe Domain Coordinates for d2vqee1:

Click to download the PDB-style file with coordinates for d2vqee1.
(The format of our PDB-style files is described here.)

Timeline for d2vqee1: