Lineage for d2vqeb1 (2vqe B:7-241)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2466923Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) (S)
    fold elaborated with additional structures
  5. 2466924Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)
  6. 2466925Protein Ribosomal protein S2 [52315] (3 species)
  7. 2466962Species Thermus thermophilus [TaxId:274] [52316] (46 PDB entries)
    Uniprot P80371
  8. 2466965Domain d2vqeb1: 2vqe B:7-241 [153427]
    Other proteins in same PDB: d2vqed1, d2vqee1, d2vqef1, d2vqeg1, d2vqeh1, d2vqei1, d2vqej1, d2vqek1, d2vqel1, d2vqem1, d2vqen1, d2vqeo1, d2vqep1, d2vqeq1, d2vqer1, d2vqes1, d2vqet1, d2vqeu1
    automatically matched to d1i94b_
    complexed with k, mg, par, zn

Details for d2vqeb1

PDB Entry: 2vqe (more details), 2.5 Å

PDB Description: modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
PDB Compounds: (B:) 30S ribosomal protein S2

SCOPe Domain Sequences for d2vqeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vqeb1 c.23.15.1 (B:7-241) Ribosomal protein S2 {Thermus thermophilus [TaxId: 274]}
vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe
ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia
ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvqe

SCOPe Domain Coordinates for d2vqeb1:

Click to download the PDB-style file with coordinates for d2vqeb1.
(The format of our PDB-style files is described here.)

Timeline for d2vqeb1: