SCOPe 2.06: Domain d2voob2: 2voo B:105-185

Lineage for d2voob2 (2voo B:105-185)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein Lupus LA protein [89940] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89941] (8 PDB entries)

8. Domain d2voob2: 2voo B:105-185 [153376]
   Other proteins in same PDB: d2vooa1, d2voob1
   automatically matched to d1s79a_
   protein/RNA complex

Details for d2voob2

PDB Entry: 2voo, 1.8 Å

PDB Description: crystal structure of n-terminal domains of human la protein complexed with rna oligomer uuuuuuuu

PDB Compounds: (B:) Lupus La protein

SCOPe Domain Sequences for d2voob2:

Sequence; same for both SEQRES and ATOM records:

>d2voob2 d.58.7.1 (B:105-185) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}
kndvknrsvyikgfptdatlddikewledkgqvlniqmrrtlhkafkgsifvvfdsiesa
kkfvetpgqkyketdllilfk

Timeline for d2voob2:

• d2voob2 first appeared in SCOP 1.75
  
• d2voob2 appears in SCOPe 2.05
  
• d2voob2 appears in SCOPe 2.07
  
• d2voob2 appears in the current release, SCOPe 2.08