Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.46: La domain [101051] (2 proteins) Pfam PF05383; RNA-binding domain |
Protein Lupus La autoantigen N-terminal domain [101052] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [101053] (7 PDB entries) |
Domain d2vooa1: 2voo A:10-103 [153373] Other proteins in same PDB: d2vooa2, d2voob2 automatically matched to d1s7aa_ protein/RNA complex |
PDB Entry: 2voo (more details), 1.8 Å
SCOPe Domain Sequences for d2vooa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vooa1 a.4.5.46 (A:10-103) Lupus La autoantigen N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} maaleakichqieyyfgdfnlprdkflkeqikldegwvpleimikfnrlnrlttdfnviv ealskskaelmeisedktkirrspskplpevtde
Timeline for d2vooa1: