Lineage for d2vona2 (2von A:105-192)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2951951Protein Lupus LA protein [89940] (1 species)
  7. 2951952Species Human (Homo sapiens) [TaxId:9606] [89941] (8 PDB entries)
  8. 2951961Domain d2vona2: 2von A:105-192 [153370]
    Other proteins in same PDB: d2vona1, d2vonb1
    automatically matched to d1s79a_
    protein/RNA complex

Details for d2vona2

PDB Entry: 2von (more details), 2.1 Å

PDB Description: crystal structure of n-terminal domains of human la protein complexed with rna oligomer auaauuu
PDB Compounds: (A:) Lupus La protein

SCOPe Domain Sequences for d2vona2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vona2 d.58.7.1 (A:105-192) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}
kndvknrsvyikgfptdatlddikewledkgqvlniqmrrtlhkafkgsifvvfdsiesa
kkfvetpgqkyketdllilfkddyfakk

SCOPe Domain Coordinates for d2vona2:

Click to download the PDB-style file with coordinates for d2vona2.
(The format of our PDB-style files is described here.)

Timeline for d2vona2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vona1