SCOP 1.75: Domain d2vodb2: 2vod B:105-192

Lineage for d2vodb2 (2vod B:105-192)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (5 families)

5. Family d.58.7.1: Canonical RBD [54929] (67 proteins)

6. Protein Lupus LA protein [89940] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89941] (8 PDB entries)

8. Domain d2vodb2: 2vod B:105-192 [153368]
   Other proteins in same PDB: d2voda1, d2vodb1
   automatically matched to d1s79a_

Details for d2vodb2

PDB Entry: 2vod, 2.1 Å

PDB Description: crystal structure of n-terminal domains of human la protein complexed with rna oligomer auauuuu

PDB Compounds: (B:) Lupus La protein

SCOP Domain Sequences for d2vodb2:

Sequence; same for both SEQRES and ATOM records:

>d2vodb2 d.58.7.1 (B:105-192) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}
kndvknrsvyikgfptdatlddikewledkgqvlniqmrrtlhkafkgsifvvfdsiesa
kkfvetpgqkyketdllilfkddyfakk

Timeline for d2vodb2:

• d2vodb2 is new in SCOP 1.75
  
• d2vodb2 appears in SCOPe 2.01
  
• d2vodb2 appears in the current release, SCOPe 2.08