SCOP 1.75: Domain d2vo7a1: 2vo7 A:14-350

Lineage for d2vo7a1 (2vo7 A:14-350)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein cAMP-dependent PK, catalytic subunit [56116] (4 species)
   AGC group; PKA subfamily; serine/threonine kinase

7. Species Cow (Bos taurus) [TaxId:9913] [56118] (32 PDB entries)
   Uniprot P00517

8. Domain d2vo7a1: 2vo7 A:14-350 [153360]
   automatically matched to d1q8ua_
   complexed with m05

Details for d2vo7a1

PDB Entry: 2vo7, 1.98 Å

PDB Description: structure of pka complexed with 4-(4-chlorobenzyl)-1-(7h- pyrrolo(2,3-d)pyrimidin-4-yl)piperidin-4-ylamine

PDB Compounds: (A:) cAMP-dependent protein kinase, alpha-catalytic subunit

SCOP Domain Sequences for d2vo7a1:

Sequence; same for both SEQRES and ATOM records:

>d2vo7a1 d.144.1.7 (A:14-350) cAMP-dependent PK, catalytic subunit {Cow (Bos taurus) [TaxId: 9913]}
svkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamki
ldkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshlr
rigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkg
rtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsg
kvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkveap
fipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

Timeline for d2vo7a1:

• d2vo7a1 is new in SCOP 1.75
  
• d2vo7a1 is called d2vo7a_ in SCOPe 2.01
  
• d2vo7a1 appears in the current release, SCOPe 2.08, called d2vo7a_