Lineage for d2vo5b5 (2vo5 B:331-678)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 815285Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 815744Family c.1.8.3: beta-glycanases [51487] (26 proteins)
    consist of a number of sequence families
  6. 816073Protein Five-domain beta-mannosidase, domain 3 [159385] (1 species)
  7. 816074Species Bacteroides thetaiotaomicron [TaxId:818] [159386] (9 PDB entries)
    Uniprot Q8AAK6 330-678! Uniprot Q8AAK6 331-678
  8. 816092Domain d2vo5b5: 2vo5 B:331-678 [153359]
    Other proteins in same PDB: d2vo5a1, d2vo5a2, d2vo5a3, d2vo5a4, d2vo5b1, d2vo5b2, d2vo5b3, d2vo5b4
    automatically matched to 2JE8 A:331-678
    complexed with br, cl, edo, vbz

Details for d2vo5b5

PDB Entry: 2vo5 (more details), 2.3 Å

PDB Description: structural and biochemical evidence for a boat-like transition state in beta-mannosidases
PDB Compounds: (B:) beta-mannosidase

SCOP Domain Sequences for d2vo5b5:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vo5b5 c.1.8.3 (B:331-678) Five-domain beta-mannosidase, domain 3 {Bacteroides thetaiotaomicron [TaxId: 818]}
rtirvvnekdkdgesfyfevngipmfakganyipqdallpnvtteryqtlfrdmkeanmn
mvriwgggtyennlfydladengilvwqdfmfactpypsdptflkrveaeavynirrlrn
haslamwcgnneilealkywgfekkftpevyqglmhgydklfrellpstvkefdsdrfyv
hsspylanwgrpeswgtgdshnwgvwygkkpfesldtdlprfmsefgfqsfpemktiaaf
aapedyqiesevmnahqkssignslirtymerdyiipesfedfvyvglvlqgqgmrhgle
ahrrnrpycmgtlywqlndswpvvswssidyygnwkalhyqakrafap

SCOP Domain Coordinates for d2vo5b5:

Click to download the PDB-style file with coordinates for d2vo5b5.
(The format of our PDB-style files is described here.)

Timeline for d2vo5b5: