Lineage for d2vo5b4 (2vo5 B:28-219)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1304969Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1304970Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1305080Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 1305230Protein Beta-mannosidase [158959] (1 species)
  7. 1305231Species Bacteroides thetaiotaomicron [TaxId:818] [158960] (9 PDB entries)
    Uniprot Q8AAK6 28-219
  8. 1305249Domain d2vo5b4: 2vo5 B:28-219 [153358]
    Other proteins in same PDB: d2vo5a1, d2vo5a2, d2vo5a3, d2vo5a5, d2vo5b1, d2vo5b2, d2vo5b3, d2vo5b5
    automatically matched to 2JE8 A:28-219
    complexed with br, cl, edo, vbz

Details for d2vo5b4

PDB Entry: 2vo5 (more details), 2.3 Å

PDB Description: structural and biochemical evidence for a boat-like transition state in beta-mannosidases
PDB Compounds: (B:) beta-mannosidase

SCOPe Domain Sequences for d2vo5b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vo5b4 b.18.1.5 (B:28-219) Beta-mannosidase {Bacteroides thetaiotaomicron [TaxId: 818]}
ndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwvene
dweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvlrk
genhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmvts
gvwrpvtlrfyd

SCOPe Domain Coordinates for d2vo5b4:

Click to download the PDB-style file with coordinates for d2vo5b4.
(The format of our PDB-style files is described here.)

Timeline for d2vo5b4: