Lineage for d2vo5b2 (2vo5 B:784-864)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 936216Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 936217Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 936501Protein Beta-mannosidase, domains 2, 4 and 5 [158905] (1 species)
    truncated domain 5 lacks the last strand
  7. 936502Species Bacteroides thetaiotaomicron [TaxId:818] [158906] (9 PDB entries)
    Uniprot Q8AAK6 220-330! Uniprot Q8AAK6 679-783! Uniprot Q8AAK6 784-864
  8. 936555Domain d2vo5b2: 2vo5 B:784-864 [153356]
    Other proteins in same PDB: d2vo5a4, d2vo5a5, d2vo5b4, d2vo5b5
    automatically matched to 2JE8 A:784-864
    complexed with br, cl, edo, vbz

Details for d2vo5b2

PDB Entry: 2vo5 (more details), 2.3 Å

PDB Description: structural and biochemical evidence for a boat-like transition state in beta-mannosidases
PDB Compounds: (B:) beta-mannosidase

SCOPe Domain Sequences for d2vo5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vo5b2 b.1.4.1 (B:784-864) Beta-mannosidase, domains 2, 4 and 5 {Bacteroides thetaiotaomicron [TaxId: 818]}
lpptsvsyqmkqtdgkceltlfssmlakdifietplqgarysdnffdllpgerkkviits
prikkgeelpvnikhiretyk

SCOPe Domain Coordinates for d2vo5b2:

Click to download the PDB-style file with coordinates for d2vo5b2.
(The format of our PDB-style files is described here.)

Timeline for d2vo5b2: