Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein automated matches [190057] (28 species) not a true protein |
Species Bacteroides thetaiotaomicron [TaxId:226186] [255614] (7 PDB entries) |
Domain d2vo5a5: 2vo5 A:331-678 [153354] Other proteins in same PDB: d2vo5a1, d2vo5a2, d2vo5a3, d2vo5a4, d2vo5b1, d2vo5b2, d2vo5b3, d2vo5b4, d2vo5b6 automated match to d2je8a5 complexed with br, cl, edo, vbz |
PDB Entry: 2vo5 (more details), 2.3 Å
SCOPe Domain Sequences for d2vo5a5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vo5a5 c.1.8.3 (A:331-678) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]} rtirvvnekdkdgesfyfevngipmfakganyipqdallpnvtteryqtlfrdmkeanmn mvriwgggtyennlfydladengilvwqdfmfactpypsdptflkrveaeavynirrlrn haslamwcgnneilealkywgfekkftpevyqglmhgydklfrellpstvkefdsdrfyv hsspylanwgrpeswgtgdshnwgvwygkkpfesldtdlprfmsefgfqsfpemktiaaf aapedyqiesevmnahqkssignslirtymerdyiipesfedfvyvglvlqgqgmrhgle ahrrnrpycmgtlywqlndswpvvswssidyygnwkalhyqakrafap
Timeline for d2vo5a5: