Lineage for d2vo5a4 (2vo5 A:28-219)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776981Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1776982Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 1777799Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 1777800Protein automated matches [190770] (31 species)
    not a true protein
  7. 1777828Species Bacteroides thetaiotaomicron [TaxId:226186] [255611] (7 PDB entries)
  8. 1777839Domain d2vo5a4: 2vo5 A:28-219 [153353]
    Other proteins in same PDB: d2vo5a1, d2vo5a2, d2vo5a3, d2vo5a5, d2vo5b1, d2vo5b2, d2vo5b3, d2vo5b5
    automated match to d2je8a4
    complexed with br, cl, edo, vbz

Details for d2vo5a4

PDB Entry: 2vo5 (more details), 2.3 Å

PDB Description: structural and biochemical evidence for a boat-like transition state in beta-mannosidases
PDB Compounds: (A:) beta-mannosidase

SCOPe Domain Sequences for d2vo5a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vo5a4 b.18.1.0 (A:28-219) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
ndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwvene
dweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvlrk
genhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmvts
gvwrpvtlrfyd

SCOPe Domain Coordinates for d2vo5a4:

Click to download the PDB-style file with coordinates for d2vo5a4.
(The format of our PDB-style files is described here.)

Timeline for d2vo5a4: