Lineage for d2vo5a1 (2vo5 A:220-330)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1521823Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 1522274Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 1522275Protein automated matches [254633] (4 species)
    not a true protein
  7. Species Bacteroides thetaiotaomicron [TaxId:226186] [255613] (7 PDB entries)
  8. 1522332Domain d2vo5a1: 2vo5 A:220-330 [153350]
    Other proteins in same PDB: d2vo5a4, d2vo5a5, d2vo5b4, d2vo5b5
    automated match to d2je8a1
    complexed with br, cl, edo, vbz

Details for d2vo5a1

PDB Entry: 2vo5 (more details), 2.3 Å

PDB Description: structural and biochemical evidence for a boat-like transition state in beta-mannosidases
PDB Compounds: (A:) beta-mannosidase

SCOPe Domain Sequences for d2vo5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vo5a1 b.1.4.0 (A:220-330) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
iatisdyyvrqlsltdenarlsnelivnqivpqkipaevrvnvslngttvtevkqqvtlq
pginhitlpaevtnpvrwmpngwgtptlydfsaqiacgdrivaeqshrigl

SCOPe Domain Coordinates for d2vo5a1:

Click to download the PDB-style file with coordinates for d2vo5a1.
(The format of our PDB-style files is described here.)

Timeline for d2vo5a1: