Class b: All beta proteins [48724] (174 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families) |
Family b.2.2.2: Cellulose-binding domain family III [49390] (8 proteins) Pfam PF00963 |
Protein Cohesin domain [49396] (2 species) |
Species Clostridium cellulolyticum [TaxId:1521] [158919] (2 PDB entries) |
Domain d2vn5a1: 2vn5 A:12-152 [153330] automatically matched to d1g1ka_ complexed with ca |
PDB Entry: 2vn5 (more details), 1.9 Å
SCOP Domain Sequences for d2vn5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vn5a1 b.2.2.2 (A:12-152) Cohesin domain {Clostridium cellulolyticum [TaxId: 1521]} slkvtvgtangkpgdtvtvpvtfadvakmknvgtcnfylgydasllevvsvdagpivkna avnfsssasngtisflfldntitdelitadgvfanikfklksvtaktttpvtfkdggafg dgtmskiasvtktngsvtidp
Timeline for d2vn5a1: