Class b: All beta proteins [48724] (176 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (24 species) not a true protein |
Domain d2vmfb4: 2vmf B:27-219 [153324] Other proteins in same PDB: d2vmfa1, d2vmfa2, d2vmfa3, d2vmfa5, d2vmfb1, d2vmfb2, d2vmfb3, d2vmfb5 automated match to d2je8a4 complexed with br, cl, edo, mvl |
PDB Entry: 2vmf (more details), 2.1 Å
SCOPe Domain Sequences for d2vmfb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vmfb4 b.18.1.0 (B:27-219) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]} gndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwven edweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvlr kgenhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmvt sgvwrpvtlrfyd
Timeline for d2vmfb4: