SCOP 1.75: Domain d2vlrj2: 2vlr J:119-244

Lineage for d2vlrj2 (2vlr J:119-244)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein T-cell antigen receptor [49125] (6 species)

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (28 PDB entries)

8. Domain d2vlrj2: 2vlr J:119-244 [153308]
   Other proteins in same PDB: d2vlra1, d2vlra2, d2vlrb1, d2vlre1, d2vlrf1, d2vlrf2, d2vlrg1, d2vlrj1
   automatically matched to d1ogae2

Details for d2vlrj2

PDB Entry: 2vlr, 2.3 Å

PDB Description: the structural dynamics and energetics of an immunodominant t-cell receptor are programmed by its vbeta domain

PDB Compounds: (J:) jm22 tcr beta chain

SCOP Domain Sequences for d2vlrj2:

Sequence; same for both SEQRES and ATOM records:

>d2vlrj2 b.1.1.2 (J:119-244) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
nvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplk
eqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsae
awgrad

Timeline for d2vlrj2:

• d2vlrj2 is new in SCOP 1.75
  
• d2vlrj2 appears in SCOPe 2.01
  
• d2vlrj2 appears in the current release, SCOPe 2.08