Lineage for d2vlrf2 (2vlr F:1-181)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2182691Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2182718Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (101 PDB entries)
    Uniprot P01892 25-298
  8. 2182813Domain d2vlrf2: 2vlr F:1-181 [153305]
    Other proteins in same PDB: d2vlra1, d2vlrb2, d2vlrb3, d2vlre1, d2vlre2, d2vlrf1, d2vlrg2, d2vlrg3, d2vlrj1, d2vlrj2
    automatically matched to d1akja2

Details for d2vlrf2

PDB Entry: 2vlr (more details), 2.3 Å

PDB Description: the structural dynamics and energetics of an immunodominant t-cell receptor are programmed by its vbeta domain
PDB Compounds: (F:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d2vlrf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vlrf2 d.19.1.1 (F:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d2vlrf2:

Click to download the PDB-style file with coordinates for d2vlrf2.
(The format of our PDB-style files is described here.)

Timeline for d2vlrf2: