SCOPe 2.07: Domain d2vlme2: 2vlm E:116-244

Lineage for d2vlme2 (2vlm E:116-244)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d2vlme2: 2vlm E:116-244 [153294]
   Other proteins in same PDB: d2vlmd2
   automated match to d3q5ya2

Details for d2vlme2

PDB Entry: 2vlm, 1.98 Å

PDB Description: the structural dynamics and energetics of an immunodominant t-cell receptor are programmed by its vbeta domain

PDB Compounds: (E:) jm22 tcr beta chain

SCOPe Domain Sequences for d2vlme2:

Sequence; same for both SEQRES and ATOM records:

>d2vlme2 b.1.1.0 (E:116-244) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Timeline for d2vlme2:

• d2vlme2 first appeared in SCOP 1.75
  
• d2vlme2 appears in SCOPe 2.06
  
• d2vlme2 appears in the current release, SCOPe 2.08