SCOPe 2.08: Domain d2vlme1: 2vlm E:5-115

Lineage for d2vlme1 (2vlm E:5-115)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d2vlme1: 2vlm E:5-115 [153293]
   Other proteins in same PDB: d2vlmd2
   automated match to d3q5ya1

Details for d2vlme1

PDB Entry: 2vlm, 1.98 Å

PDB Description: the structural dynamics and energetics of an immunodominant t-cell receptor are programmed by its vbeta domain

PDB Compounds: (E:) jm22 tcr beta chain

SCOPe Domain Sequences for d2vlme1:

Sequence; same for both SEQRES and ATOM records:

>d2vlme1 b.1.1.0 (E:5-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gitqspkylfrkegqnvtlsceqnlnhdamywyrqdpgqglrliyysqivndfqkgdiae
gysvsrekkesfpltvtsaqknptafylcasssrssyeqyfgpgtrltvte

Timeline for d2vlme1:

• d2vlme1 first appeared in SCOP 1.75
  
• d2vlme1 appears in SCOPe 2.07