SCOPe 2.07: Domain d2vlld2: 2vll D:1-181

Lineage for d2vlld2 (2vll D:1-181)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (103 PDB entries)
   Uniprot P01892 25-298

8. Domain d2vlld2: 2vll D:1-181 [153291]
   Other proteins in same PDB: d2vlla1, d2vllb2, d2vllb3, d2vlld1, d2vlle2, d2vlle3
   automatically matched to d1akja2

Details for d2vlld2

PDB Entry: 2vll, 1.6 Å

PDB Description: the structural dynamics and energetics of an immunodominant t-cell receptor are programmed by its vbeta domain

PDB Compounds: (D:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d2vlld2:

Sequence; same for both SEQRES and ATOM records:

>d2vlld2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d2vlld2:

• d2vlld2 first appeared in SCOP 1.75
  
• d2vlld2 appears in SCOPe 2.06
  
• d2vlld2 appears in the current release, SCOPe 2.08