![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species) |
![]() | Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (76 PDB entries) Uniprot P01892 25-298 |
![]() | Domain d2vlla2: 2vll A:1-181 [153288] Other proteins in same PDB: d2vlla1, d2vllb_, d2vlld1, d2vlle_ automatically matched to d1akja2 |
PDB Entry: 2vll (more details), 1.6 Å
SCOPe Domain Sequences for d2vlla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vlla2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]} gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq r
Timeline for d2vlla2:
![]() Domains from other chains: (mouse over for more information) d2vllb_, d2vlld1, d2vlld2, d2vlle_ |