SCOPe 2.03: Domain d2vlje1: 2vlj E:5-118

Lineage for d2vlje1 (2vlj E:5-118)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (32 PDB entries)

8. Domain d2vlje1: 2vlj E:5-118 [153280]
   Other proteins in same PDB: d2vlja1, d2vlja2, d2vljb_, d2vlje2
   automatically matched to d1ogae1

Details for d2vlje1

PDB Entry: 2vlj, 2.4 Å

PDB Description: the structural dynamics and energetics of an immunodominant t-cell receptor are programmed by its vbeta domain

PDB Compounds: (E:) jm22 tcr beta chain

SCOPe Domain Sequences for d2vlje1:

Sequence; same for both SEQRES and ATOM records:

>d2vlje1 b.1.1.1 (E:5-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
gitqspkylfrkegqnvtlsceqnlnhdamywyrqdpgqglrliyysqivndfqkgdiae
gysvsrekkesfpltvtsaqknptafylcasssrssyeqyfgpgtrltvtedlk

Timeline for d2vlje1:

• d2vlje1 first appeared in SCOP 1.75
  
• d2vlje1 appears in SCOPe 2.02
  
• d2vlje1 appears in SCOPe 2.04
  
• d2vlje1 appears in the current release, SCOPe 2.08