Lineage for d2vl4b1 (2vl4 B:220-330)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1768157Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 1768616Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 1768617Protein automated matches [254633] (7 species)
    not a true protein
  7. 1768643Species Bacteroides thetaiotaomicron [TaxId:226186] [255613] (7 PDB entries)
  8. 1768659Domain d2vl4b1: 2vl4 B:220-330 [153259]
    Other proteins in same PDB: d2vl4a4, d2vl4a5, d2vl4b4, d2vl4b5
    automated match to d2je8a1
    complexed with br, cl, edo, mnm

Details for d2vl4b1

PDB Entry: 2vl4 (more details), 1.9 Å

PDB Description: structural and biochemical evidence for a boat-like transition state in beta-mannosidases
PDB Compounds: (B:) beta-mannosidase

SCOPe Domain Sequences for d2vl4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vl4b1 b.1.4.0 (B:220-330) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
iatisdyyvrqlsltdenarlsnelivnqivpqkipaevrvnvslngttvtevkqqvtlq
pginhitlpaevtnpvrwmpngwgtptlydfsaqiacgdrivaeqshrigl

SCOPe Domain Coordinates for d2vl4b1:

Click to download the PDB-style file with coordinates for d2vl4b1.
(The format of our PDB-style files is described here.)

Timeline for d2vl4b1: