SCOPe 2.04: Domain d2vkxd2: 2vkx D:601-693

Lineage for d2vkxd2 (2vkx D:601-693)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Neural cell adhesion molecule 1, NCAM [89197] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141033] (4 PDB entries)
   Uniprot P13592 498-598

8. Domain d2vkxd2: 2vkx D:601-693 [153243]
   automatically matched to d1lwra_
   complexed with so4; mutant

Details for d2vkxd2

PDB Entry: 2vkx, 2.7 Å

PDB Description: human ncam, fn3 domains 1 and 2, m610r mutant

PDB Compounds: (D:) neural cell adhesion molecule

SCOPe Domain Sequences for d2vkxd2:

Sequence; same for both SEQRES and ATOM records:

>d2vkxd2 b.1.2.1 (D:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]}
psapklegqrgedgnsikvnlikqddggspirhylvryralssewkpeirlpsgsdhvml
ksldwnaeyevyvvaenqqgkskaahfvfrtaa

Timeline for d2vkxd2:

• d2vkxd2 first appeared in SCOP 1.75
  
• d2vkxd2 appears in SCOPe 2.03
  
• d2vkxd2 appears in SCOPe 2.05
  
• d2vkxd2 appears in the current release, SCOPe 2.08