SCOPe 2.04: Domain d2vkxc1: 2vkx C:498-598

Lineage for d2vkxc1 (2vkx C:498-598)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Neural cell adhesion molecule 1, NCAM [89197] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141033] (4 PDB entries)
   Uniprot P13592 498-598

8. Domain d2vkxc1: 2vkx C:498-598 [153240]
   automatically matched to d2haza1
   complexed with so4; mutant

Details for d2vkxc1

PDB Entry: 2vkx, 2.7 Å

PDB Description: human ncam, fn3 domains 1 and 2, m610r mutant

PDB Compounds: (C:) neural cell adhesion molecule

SCOPe Domain Sequences for d2vkxc1:

Sequence; same for both SEQRES and ATOM records:

>d2vkxc1 b.1.2.1 (C:498-598) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]}
dtpsspsidqvepysstaqvqfdepeatggvpilkykaewravgeevwhskwydakeasm
egivtivglkpettyavrlaalngkglgeisaasefktqpv

Timeline for d2vkxc1:

• d2vkxc1 first appeared in SCOP 1.75
  
• d2vkxc1 appears in SCOPe 2.03
  
• d2vkxc1 appears in SCOPe 2.05
  
• d2vkxc1 appears in the current release, SCOPe 2.08