Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Neural cell adhesion molecule 1, NCAM [89197] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [141033] (4 PDB entries) Uniprot P13592 498-598 |
Domain d2vkwa2: 2vkw A:601-691 [153233] Other proteins in same PDB: d2vkwa3, d2vkwb3 automatically matched to d1lwra_ complexed with so4 |
PDB Entry: 2vkw (more details), 2.3 Å
SCOPe Domain Sequences for d2vkwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vkwa2 b.1.2.1 (A:601-691) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} psapklegqmgedgnsikvnlikqddggspirhylvryralssewkpeirlpsgsdhvml ksldwnaeyevyvvaenqqgkskaahfvfrt
Timeline for d2vkwa2: