Class b: All beta proteins [48724] (174 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) |
Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
Protein Beta-mannosidase [158959] (1 species) |
Species Bacteroides thetaiotaomicron [TaxId:818] [158960] (9 PDB entries) Uniprot Q8AAK6 28-219 |
Domain d2vjxa4: 2vjx A:28-219 [153206] Other proteins in same PDB: d2vjxa1, d2vjxa2, d2vjxa3, d2vjxa5, d2vjxb1, d2vjxb2, d2vjxb3, d2vjxb5 automatically matched to 2JE8 A:28-219 complexed with br, cl, edo, ifl |
PDB Entry: 2vjx (more details), 1.85 Å
SCOPe Domain Sequences for d2vjxa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vjxa4 b.18.1.5 (A:28-219) Beta-mannosidase {Bacteroides thetaiotaomicron [TaxId: 818]} ndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwvene dweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvlrk genhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmvts gvwrpvtlrfyd
Timeline for d2vjxa4: