Lineage for d2vjab_ (2vja B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2899461Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins)
    automatically mapped to Pfam PF00135
  6. 2899462Protein Acetylcholinesterase [53476] (6 species)
  7. 2899646Species Pacific electric ray (Torpedo californica) [TaxId:7787] [53477] (98 PDB entries)
    Uniprot P04058 25-556
  8. 2899684Domain d2vjab_: 2vja B: [153187]
    automated match to d1evea_
    complexed with ccd, cl, nag, pge

Details for d2vjab_

PDB Entry: 2vja (more details), 2.3 Å

PDB Description: torpedo californica acetylcholinesterase in complex with a non hydrolysable substrate analogue, 4-oxo-n,n,n- trimethylpentanaminium - orthorhombic space group - dataset a at 100k
PDB Compounds: (B:) acetylcholinesterase

SCOPe Domain Sequences for d2vjab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vjab_ c.69.1.1 (B:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]}
sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
ephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat

SCOPe Domain Coordinates for d2vjab_:

Click to download the PDB-style file with coordinates for d2vjab_.
(The format of our PDB-style files is described here.)

Timeline for d2vjab_: