Lineage for d2vj3a2 (2vj3 A:453-491)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1960255Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1961206Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 1961820Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 1961821Protein automated matches [226968] (3 species)
    not a true protein
  7. 1961822Species Human (Homo sapiens) [TaxId:9606] [225423] (24 PDB entries)
  8. 1961856Domain d2vj3a2: 2vj3 A:453-491 [153181]
    automated match to d2vj3a2
    complexed with ca, cl, na

Details for d2vj3a2

PDB Entry: 2vj3 (more details), 2.6 Å

PDB Description: human notch-1 egfs 11-13
PDB Compounds: (A:) Neurogenic locus notch homolog protein 1

SCOPe Domain Sequences for d2vj3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vj3a2 g.3.11.0 (A:453-491) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vnecvsnpcqndatcldqigefqcicmpgyegvhcevnt

SCOPe Domain Coordinates for d2vj3a2:

Click to download the PDB-style file with coordinates for d2vj3a2.
(The format of our PDB-style files is described here.)

Timeline for d2vj3a2: